Icon representing a puzzle

2561: Revisiting Puzzle 90: Heliomicin

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
January 15, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,850
  2. Avatar for Go Science 2. Go Science 65 pts. 9,808
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 9,709
  4. Avatar for Contenders 4. Contenders 24 pts. 9,658
  5. Avatar for Australia 5. Australia 14 pts. 9,657
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 9,612
  7. Avatar for VeFold 7. VeFold 4 pts. 9,585
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,571
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,546
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,501
  1. Avatar for BootsMcGraw 11. BootsMcGraw Lv 1 46 pts. 9,658
  2. Avatar for Aubade01 12. Aubade01 Lv 1 42 pts. 9,658
  3. Avatar for AlkiP0Ps 13. AlkiP0Ps Lv 1 39 pts. 9,657
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 36 pts. 9,657
  5. Avatar for meatexplosion 15. meatexplosion Lv 1 33 pts. 9,654
  6. Avatar for Galaxie 16. Galaxie Lv 1 30 pts. 9,633
  7. Avatar for g_b 17. g_b Lv 1 27 pts. 9,626
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 25 pts. 9,616
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 23 pts. 9,612
  10. Avatar for BarrySampson 20. BarrySampson Lv 1 20 pts. 9,585

Comments