Foldit Puzzles

2528: Revisiting Puzzle 79: Pheromone

This is a throwback puzzle to the early days of Foldit. This pheromone protein is secreted by the protist E. raikovi to initiate conjugation, the exchange of genetic material between two cells. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

2527: KCNQ1 VSD Round 6

KCNQ1 is a critical gene that helps regulate the heart's rhythm by encoding the Kv7.1 potassium ion channel. Mutations in KCNQ1 can cause congenital long QT syndrome (LQTS), an inherited heart condition that increases the risk of sudden cardiac death, especially in young people. While previous puzzles have focused on one domain of KCNQ1, in this challenge we're taking a similar but different approach by targeting the Voltage Sensing Domain (VSD) of KCNQ1.

2526: Refine Density Reconstruction 11

This is a protein we've given before in puzzle 2306, which was Reconstruction Puzzle 41, but now we have the Refine Density tool available to make folds even better!

2525: Revisiting Puzzle 77: Copper Chaperone

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

2524: KCNQ1 VSD Round 5

KCNQ1 is a critical gene that helps regulate the heart's rhythm by encoding the Kv7.1 potassium ion channel. Mutations in KCNQ1 can cause congenital long QT syndrome (LQTS), an inherited heart condition that increases the risk of sudden cardiac death, especially in young people. While previous puzzles have focused on one domain of KCNQ1, in this challenge we're taking a similar but different approach by targeting the Voltage Sensing Domain (VSD) of KCNQ1.

2523: Refine Density Reconstruction 10

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

2522: Revisiting Puzzle 76: Plant Seed Protein

This is a throwback puzzle to the early days of Foldit. This storage protein is used to stockpile amino acids for future use, and is found at high concentration in the seeds of certain plants. This particular protein was used by scientists in 2011 to collect the highest-resolution crystal structure to date. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

2521: KCNQ1 VSD Round 4

KCNQ1 is a critical gene that helps regulate the heart's rhythm by encoding the Kv7.1 potassium ion channel. Mutations in KCNQ1 can cause congenital long QT syndrome (LQTS), an inherited heart condition that increases the risk of sudden cardiac death, especially in young people. While previous puzzles have focused on one domain of KCNQ1, in this challenge we're taking a similar but different approach by targeting the Voltage Sensing Domain (VSD) of KCNQ1.

2520: Refine Density Reconstruction 9

This is a protein we've given before in puzzle 2326, which was Reconstruction Puzzle 48, but now we have the Refine Density tool available to make folds even better! This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

2519: Revisiting Puzzle 75: Antifreeze Protein

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.