Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for yoyoparis 91. yoyoparis Lv 1 2 pts. 8,781
  2. Avatar for TR02 92. TR02 Lv 1 2 pts. 8,768
  3. Avatar for Superphosphate 93. Superphosphate Lv 1 2 pts. 8,751
  4. Avatar for Sadoone 94. Sadoone Lv 1 2 pts. 8,700
  5. Avatar for Bushman 95. Bushman Lv 1 2 pts. 8,685
  6. Avatar for mitarcher 96. mitarcher Lv 1 2 pts. 8,679
  7. Avatar for Arne Heessels 97. Arne Heessels Lv 1 2 pts. 8,639
  8. Avatar for bcre8tvv 98. bcre8tvv Lv 1 2 pts. 8,626
  9. Avatar for Jim Fraser 99. Jim Fraser Lv 1 2 pts. 8,523
  10. Avatar for nathanmills 100. nathanmills Lv 1 2 pts. 8,502

Comments