Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745
  1. Avatar for Flagg65a 71. Flagg65a Lv 1 6 pts. 9,079
  2. Avatar for andrewtmaxwell 72. andrewtmaxwell Lv 1 6 pts. 9,072
  3. Avatar for hada 73. hada Lv 1 6 pts. 9,032
  4. Avatar for atlas100 74. atlas100 Lv 1 5 pts. 9,024
  5. Avatar for JSmith48 75. JSmith48 Lv 1 5 pts. 9,023
  6. Avatar for Merf 76. Merf Lv 1 5 pts. 9,013
  7. Avatar for rezaefar 77. rezaefar Lv 1 4 pts. 8,981
  8. Avatar for Tlaloc 78. Tlaloc Lv 1 4 pts. 8,979
  9. Avatar for jobo0502 79. jobo0502 Lv 1 4 pts. 8,965
  10. Avatar for rabamino12358 80. rabamino12358 Lv 1 4 pts. 8,945

Comments