Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,000
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,848
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 10,848
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 10,846
  5. Avatar for Go Science 5. Go Science 29 pts. 10,833
  6. Avatar for Contenders 6. Contenders 20 pts. 10,736
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,734
  8. Avatar for Russian team 8. Russian team 9 pts. 10,727
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 10,718
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,697
  1. Avatar for manu8170 61. manu8170 Lv 1 5 pts. 10,261
  2. Avatar for Idiotboy 62. Idiotboy Lv 1 5 pts. 10,257
  3. Avatar for ManVsYard 63. ManVsYard Lv 1 4 pts. 10,256
  4. Avatar for JasperD 64. JasperD Lv 1 4 pts. 10,211
  5. Avatar for Altercomp 65. Altercomp Lv 1 4 pts. 10,199
  6. Avatar for altejoh 66. altejoh Lv 1 4 pts. 10,197
  7. Avatar for orily1337 67. orily1337 Lv 1 3 pts. 10,196
  8. Avatar for Dhalion 68. Dhalion Lv 1 3 pts. 10,195
  9. Avatar for Sissue 69. Sissue Lv 1 3 pts. 10,183
  10. Avatar for RockOn 70. RockOn Lv 1 3 pts. 10,182

Comments