Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,000
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,848
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 10,848
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 10,846
  5. Avatar for Go Science 5. Go Science 29 pts. 10,833
  6. Avatar for Contenders 6. Contenders 20 pts. 10,736
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,734
  8. Avatar for Russian team 8. Russian team 9 pts. 10,727
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 10,718
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,697
  1. Avatar for katling 51. katling Lv 1 9 pts. 10,466
  2. Avatar for timroberts16 52. timroberts16 Lv 1 9 pts. 10,407
  3. Avatar for andromeda72 53. andromeda72 Lv 1 8 pts. 10,400
  4. Avatar for rezaefar 54. rezaefar Lv 1 8 pts. 10,380
  5. Avatar for DoctorSockrates 55. DoctorSockrates Lv 1 7 pts. 10,370
  6. Avatar for Maerlyn138 56. Maerlyn138 Lv 1 7 pts. 10,347
  7. Avatar for zgf2022 57. zgf2022 Lv 1 6 pts. 10,328
  8. Avatar for alcor29 58. alcor29 Lv 1 6 pts. 10,317
  9. Avatar for drumpeter18yrs9yrs 59. drumpeter18yrs9yrs Lv 1 6 pts. 10,315
  10. Avatar for Bletchley Park 60. Bletchley Park Lv 1 5 pts. 10,289

Comments