Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569
  1. Avatar for Todd6485577 61. Todd6485577 Lv 1 8 pts. 11,336
  2. Avatar for pvc78 62. pvc78 Lv 1 8 pts. 11,310
  3. Avatar for GuR0 63. GuR0 Lv 1 7 pts. 11,298
  4. Avatar for drumpeter18yrs9yrs 64. drumpeter18yrs9yrs Lv 1 7 pts. 11,263
  5. Avatar for Beany 65. Beany Lv 1 7 pts. 11,258
  6. Avatar for dahast.de 66. dahast.de Lv 1 6 pts. 11,214
  7. Avatar for kyoota 67. kyoota Lv 1 6 pts. 11,206
  8. Avatar for tracybutt 68. tracybutt Lv 1 6 pts. 11,195
  9. Avatar for Glen B 69. Glen B Lv 1 5 pts. 11,191
  10. Avatar for heather-1 70. heather-1 Lv 1 5 pts. 11,162

Comments