Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569

  1. Avatar for Hellcat6 71. Hellcat6 Lv 1 5 pts. 11,116
  2. Avatar for rezaefar 72. rezaefar Lv 1 4 pts. 11,109
  3. Avatar for SKSbell 73. SKSbell Lv 1 4 pts. 11,103
  4. Avatar for Dhalion 74. Dhalion Lv 1 4 pts. 11,038
  5. Avatar for infjamc 75. infjamc Lv 1 4 pts. 11,029
  6. Avatar for gertvtr 76. gertvtr Lv 1 4 pts. 10,946
  7. Avatar for kevin everington 77. kevin everington Lv 1 3 pts. 10,906
  8. Avatar for equilibria 78. equilibria Lv 1 3 pts. 10,879
  9. Avatar for faues 79. faues Lv 1 3 pts. 10,864
  10. Avatar for Bearpaw 80. Bearpaw Lv 1 3 pts. 10,862

Comments