Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570
  1. Avatar for abiogenesis 71. abiogenesis Lv 1 9 pts. 9,400
  2. Avatar for Maximus150 72. Maximus150 Lv 1 8 pts. 9,370
  3. Avatar for Dr.Sillem 73. Dr.Sillem Lv 1 8 pts. 9,332
  4. Avatar for DScott 74. DScott Lv 1 8 pts. 9,303
  5. Avatar for B_612 75. B_612 Lv 1 7 pts. 9,296
  6. Avatar for Beany 76. Beany Lv 1 7 pts. 9,285
  7. Avatar for cjddig 77. cjddig Lv 1 7 pts. 9,241
  8. Avatar for cmlehm 78. cmlehm Lv 1 6 pts. 9,221
  9. Avatar for AlphaFold2 79. AlphaFold2 Lv 1 6 pts. 9,156
  10. Avatar for antibot215 80. antibot215 Lv 1 6 pts. 9,071

Comments