Icon representing a puzzle

2324: Revisiting Puzzle 86: Nematode

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,191
  2. Avatar for Go Science 2. Go Science 56 pts. 11,127
  3. Avatar for Contenders 3. Contenders 29 pts. 11,093
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 10,823
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 10,616
  6. Avatar for Gargleblasters 6. Gargleblasters 2 pts. 10,594
  7. Avatar for Australia 7. Australia 1 pt. 10,439
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,345
  9. Avatar for VeFold 9. VeFold 1 pt. 9,422
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 9,140

  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 50 pts. 10,876
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 47 pts. 10,864
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 43 pts. 10,823
  4. Avatar for gmn 14. gmn Lv 1 40 pts. 10,781
  5. Avatar for g_b 15. g_b Lv 1 37 pts. 10,781
  6. Avatar for Punzi Baker 3 16. Punzi Baker 3 Lv 1 34 pts. 10,769
  7. Avatar for akaaka 17. akaaka Lv 1 32 pts. 10,760
  8. Avatar for SemperRabbit 18. SemperRabbit Lv 1 29 pts. 10,743
  9. Avatar for guineapig 19. guineapig Lv 1 27 pts. 10,680
  10. Avatar for silent gene 20. silent gene Lv 1 25 pts. 10,652

Comments