Icon representing a puzzle

2324: Revisiting Puzzle 86: Nematode

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,191
  2. Avatar for Go Science 2. Go Science 56 pts. 11,127
  3. Avatar for Contenders 3. Contenders 29 pts. 11,093
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 10,823
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 10,616
  6. Avatar for Gargleblasters 6. Gargleblasters 2 pts. 10,594
  7. Avatar for Australia 7. Australia 1 pt. 10,439
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,345
  9. Avatar for VeFold 9. VeFold 1 pt. 9,422
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 9,140
  1. Avatar for fpc 21. fpc Lv 1 23 pts. 10,616
  2. Avatar for Joanna_H 22. Joanna_H Lv 1 21 pts. 10,594
  3. Avatar for Idiotboy 23. Idiotboy Lv 1 19 pts. 10,479
  4. Avatar for alcor29 24. alcor29 Lv 1 17 pts. 10,469
  5. Avatar for AlkiP0Ps 25. AlkiP0Ps Lv 1 16 pts. 10,439
  6. Avatar for heather-1 26. heather-1 Lv 1 15 pts. 10,398
  7. Avatar for Flagg65a 27. Flagg65a Lv 1 13 pts. 10,354
  8. Avatar for phi16 28. phi16 Lv 1 12 pts. 10,345
  9. Avatar for WBarme1234 29. WBarme1234 Lv 1 11 pts. 10,345
  10. Avatar for georg137 30. georg137 Lv 1 10 pts. 10,265

Comments