Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570
  1. Avatar for mart0258 91. mart0258 Lv 1 3 pts. 8,811
  2. Avatar for pruneau_44 92. pruneau_44 Lv 1 3 pts. 8,752
  3. Avatar for tracybutt 93. tracybutt Lv 1 3 pts. 8,742
  4. Avatar for rinze 94. rinze Lv 1 3 pts. 8,725
  5. Avatar for Arthemian 95. Arthemian Lv 1 3 pts. 8,678
  6. Avatar for bergie72 96. bergie72 Lv 1 3 pts. 8,659
  7. Avatar for OhThreeOhNo 97. OhThreeOhNo Lv 1 3 pts. 8,651
  8. Avatar for itswyld 98. itswyld Lv 1 2 pts. 8,633
  9. Avatar for imgil25 99. imgil25 Lv 1 2 pts. 8,632
  10. Avatar for mfung 100. mfung Lv 1 2 pts. 8,604

Comments